HORDB

ID: hor001508
Uniprot ID: Q18502
Protein name: KPSFVRF-amide
Gene name: flp-9
Organism: Caenorhabditis elegans
Family: FARP (FMRFamide related peptide) family
Source: animal
Expression: Expressed in eggs and larvae, but not in adults. |Each flp gene is expressed in a distinct set of neurons.
Disease: NA
Comments: NA
Taxonomy: Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0071855 neuropeptide receptor binding
GO BP: GO:0001508 action potential; GO:0007218 neuropeptide signaling pathway; GO:0007626 locomotory behavior
GO CC: GO:0005576 extracellular region

Sequence: KPSFVRF
Length: 7
Propeptide: MNQFYALFLVACIAAMANAYEEPDLDALAEFCGKESNRKYCDQIAQLATQHAIGINQEQVRMEKRKPSFVRFGKRSGYPLVIDDEEMRMDKRKPSFVRFGRK
Signal peptide: MNQFYALFLVACIAAMANA
Modification: T7 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: Inhibits contraction of vaginal vera muscle, and inhibits the activity of the dissected pharyngeal myogenic muscle system
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001508_AF2.pdb

hor001508_ESM.pdb

Mass:	98724	Formula:	C43H65N11O9
Absent amino acids:	ACDEGHILMNQTWY	Common amino acids:	F
pI:	11.65	Basic residues:	2
Polar residues:	1	Hydrophobic residues:	3
Hydrophobicity:	-14.29	Boman Index:	-1387
Half-Life:	1.3 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	41.43
Instability Index:	2531.43	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 9920762
Title: Isolation, Pharmacology and Gene Organization of KPSFVRFamide: A Neuropeptide From Caenorhabditis Elegans.
PubMed ID: 16061202
Title: Discovering Neuropeptides in Caenorhabditis Elegans by Two Dimensional Liquid Chromatography and Mass Spectrometry