General Information

  • ID:  hor001508
  • Uniprot ID:  Q18502
  • Protein name:  KPSFVRF-amide
  • Gene name:  flp-9
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed in eggs and larvae, but not in adults. |Each flp gene is expressed in a distinct set of neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0001508 action potential; GO:0007218 neuropeptide signaling pathway; GO:0007626 locomotory behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  KPSFVRF
  • Length:  7(66-72)
  • Propeptide:  MNQFYALFLVACIAAMANAYEEPDLDALAEFCGKESNRKYCDQIAQLATQHAIGINQEQVRMEKRKPSFVRFGKRSGYPLVIDDEEMRMDKRKPSFVRFGRK
  • Signal peptide:  MNQFYALFLVACIAAMANA
  • Modification:  T7 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits contraction of vaginal vera muscle, and inhibits the activity of the dissected pharyngeal myogenic muscle system
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q18502-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001508_AF2.pdbhor001508_ESM.pdb

Physical Information

Mass: 98724 Formula: C43H65N11O9
Absent amino acids: ACDEGHILMNQTWY Common amino acids: F
pI: 11.65 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -14.29 Boman Index: -1387
Half-Life / Aliphatic Index: 1.3 hour Aliphatic Index: 41.43
Instability Index: 2531.43 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  9920762
  • Title:  Isolation, Pharmacology and Gene Organization of KPSFVRFamide: A Neuropeptide From Caenorhabditis Elegans.
  • PubMed ID:  16061202
  • Title:  Discovering Neuropeptides in Caenorhabditis Elegans by Two Dimensional Liquid Chromatography and Mass Spectrometry